- Frizzled-10 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85754
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: ERLNMDYWKI LAAQHKCKMN NQTKTLDCLM AASI
- CD350, FZ-10, Fz10, FzE7, hFz10
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- 0.1 ml (also 25ul)
- Frizzled-10
- Human
- frizzled class receptor 10
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASI
Specifications/Features
Available conjugates: Unconjugated